McDonnell Genome Institute

Washington University

Transcript

lnc-POU2AF1-6:1

Chromosome

chr11

Gene Name

lnc-POU2AF1-6

Start

111103945

CPC Label

noncoding

End

111104860

Cancer

CCRC

Strand

-

Peptide

LHTPAGK

Modified Peptide

n[230]LHTPAGK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

LEKLHTPAGKLEESLYWKQRMLNVNMQMEMRSPTQPHSAS

Conservation Score

0.047

PhyloCSF Frame 1

-5.774

No. of Spectra

14

CPC Coding Probability

0.0516774

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

-4.546

CNTI Score

-0.403350087