McDonnell Genome Institute

Washington University

Transcript

lnc-POU1F1-4:1

Chromosome

chr3

Gene Name

lnc-POU1F1-4

Start

87630300

CPC Label

noncoding

End

87631619

Cancer

BRCA-Basal-like

Strand

-

Peptide

AVCTEGDLMTLR

Modified Peptide

n[145]AVCTEGDLMTLR

Peptide Length

12

ORF Length

68

Open Reading Frame (ORF)

LPDKRMKKYIFQIHMNNTTLASDVTLDNLITAKDDLFGADIKAVCTEGDLMTLRESRMKVTNEDFKKT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.262729

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.561

PhyloCSF Frame 3

0

CNTI Score

-0.321658285