McDonnell Genome Institute

Washington University

Transcript

lnc-POTEG-26:1

Chromosome

chr14

Gene Name

lnc-POTEG-26

Start

18976747

CPC Label

noncoding

End

18980793

Cancer

OV

Strand

-

Peptide

FLTFSFLSMVEPPR

Modified Peptide

n[145]FLTFSFLSMVEPPR

Peptide Length

14

ORF Length

57

Open Reading Frame (ORF)

MCNMTCASVFFCDQKFLTFSFLSMVEPPRAGVLNSQATDSYQSTDYYEPHHTGGGEH

Conservation Score

0.033

PhyloCSF Frame 1

0

No. of Spectra

67

CPC Coding Probability

0.0292123

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.394168421