McDonnell Genome Institute

Washington University

Transcript

lnc-POTEG-23:3

Chromosome

chr14

Gene Name

lnc-POTEG-23

Start

19152323

CPC Label

noncoding

End

19155035

Cancer

HCC

Strand

-

Peptide

IIGMTDFLLR

Modified Peptide

n[230]IIGMTDFLLR

Peptide Length

10

ORF Length

55

Open Reading Frame (ORF)

LKGCIIYKIIGMTDFLLRRQGQGRAYCYRKDRHSLKFHLKDLQKPKRNKKSQIYR

Conservation Score

0.055

PhyloCSF Frame 1

-3.724

No. of Spectra

1

CPC Coding Probability

0.0375387

PhyloCSF Frame 2 

-3.717

CNTI Index

noncoding

Max Probability

0.7411

PhyloCSF Frame 3

0

CNTI Score

-0.496317603