McDonnell Genome Institute

Washington University

Transcript

lnc-POTEG-16:1

Chromosome

chr14

Gene Name

lnc-POTEG-16

Start

18645043

CPC Label

coding

End

18646221

Cancer

PRAD

Strand

-

Peptide

VPMSPSPQNYGSGMRPPPNSLGPAMPGINMGPGAGRP

Modified Peptide

VPM[147]SPSPQNYGSGMRPPPNSLGPAM[147]PGINMGPGAGRP

Peptide Length

37

ORF Length

38

Open Reading Frame (ORF)

MVPMSPSPQNYGSGMRPPPNSLGPAMPGINMGPGAGRP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.878448

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5426

PhyloCSF Frame 3

0

CNTI Score

-0.325657304