McDonnell Genome Institute

Washington University

Transcript

ZSCAN16-AS1:12

Chromosome

chr6

Gene Name

ZSCAN16-AS1

Start

28135268

CPC Label

noncoding

End

28136844

Cancer

CCRC

Strand

-

Peptide

LHYLSLSCGMVFCR

Modified Peptide

n[230]LHYLSLSCGM[147]VFCR

Peptide Length

14

ORF Length

33

Open Reading Frame (ORF)

LHYLSLSCGMVFCRTEGQFYLINRNIMGFTYVI

Conservation Score

0.522

PhyloCSF Frame 1

-4.513

No. of Spectra

6

CPC Coding Probability

0.0460363

PhyloCSF Frame 2 

-4.645

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

-4.327

CNTI Score

-0.374226743