McDonnell Genome Institute

Washington University

Transcript

ZRANB2-AS2:48

Chromosome

chr1

Gene Name

ZRANB2-AS2

Start

71081352

CPC Label

noncoding

End

71259675

Cancer

HCC

Strand

+

Peptide

IQEAILDFK

Modified Peptide

n[230]IQEAILDFK

Peptide Length

9

ORF Length

90

Open Reading Frame (ORF)

MLYCISSPMFLKLSNQLWNDGNKRIQEAILDFKFKKPWSRCKTENIWTYIYLPRLDRIPRNGKGEQIGCLRTGVISPSRDHQALSKARIL

Conservation Score

0.988

PhyloCSF Frame 1

-3.897

No. of Spectra

19

CPC Coding Probability

0.159933

PhyloCSF Frame 2 

-5.686

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

-4.294

CNTI Score

-0.360663745