McDonnell Genome Institute

Washington University

Transcript

ZRANB2-AS2:43

Chromosome

chr1

Gene Name

ZRANB2-AS2

Start

71081352

CPC Label

noncoding

End

71100920

Cancer

BRCA-Basal-like

Strand

+

Peptide

LGLSCIMLMLSLSQPDNK

Modified Peptide

n[145]LGLSCIMLMLSLSQPDNK

Peptide Length

18

ORF Length

68

Open Reading Frame (ORF)

LGLSCIMLMLSLSQPDNKMIHLSNTSRQRRRYYIFSRCVPLPEPVQCFLWAEHTHTETPSSTIFHVFC

Conservation Score

1

PhyloCSF Frame 1

-3.658

No. of Spectra

27

CPC Coding Probability

0.223035

PhyloCSF Frame 2 

-3.373

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-4.293

CNTI Score

-0.374834575