McDonnell Genome Institute

Washington University

Transcript

ZRANB2-AS2:32

Chromosome

chr1

Gene Name

ZRANB2-AS2

Start

71407643

CPC Label

noncoding

End

71489969

Cancer

OV

Strand

+

Peptide

MKIIEIIESTSQGCEIK

Modified Peptide

n[145]M[147]KIIEIIESTSQGCEIK

Peptide Length

17

ORF Length

55

Open Reading Frame (ORF)

LILLYDNVWAMWLTSQSFSFLKGKMKIIEIIESTSQGCEIKGDERYIGPCSGKFP

Conservation Score

0.95

PhyloCSF Frame 1

-3.997

No. of Spectra

2

CPC Coding Probability

0.0167671

PhyloCSF Frame 2 

-4.613

CNTI Index

noncoding

Max Probability

0.4636

PhyloCSF Frame 3

-5.757

CNTI Score

-0.475788731