McDonnell Genome Institute

Washington University

Transcript

ZNF674-AS1:9

Chromosome

chrX

Gene Name

ZNF674-AS1

Start

46545518

CPC Label

noncoding

End

46559681

Cancer

OV

Strand

+

Peptide

LVSNSWAQAILPQPPK

Modified Peptide

n[145]LVSNSWAQAILPQPPK

Peptide Length

16

ORF Length

36

Open Reading Frame (ORF)

LPRLVSNSWAQAILPQPPKILGLQVWAPMPSKGSFL

Conservation Score

0.39

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0748538

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8843

PhyloCSF Frame 3

0

CNTI Score

-0.368442658