McDonnell Genome Institute

Washington University

Transcript

ZNF582-AS1:18

Chromosome

chr19

Gene Name

ZNF582-AS1

Start

56393732

CPC Label

noncoding

End

56399168

Cancer

CCRC

Strand

+

Peptide

LSDSFDLILFPSNLR

Modified Peptide

n[272]LSDSFDLILFPSNLR

Peptide Length

15

ORF Length

53

Open Reading Frame (ORF)

LSDSFDLILFPSNLRWEPHCIAQAGLELRSSSDRLASALQNDGEAASLSGVNT

Conservation Score

0.176

PhyloCSF Frame 1

0

No. of Spectra

88

CPC Coding Probability

0.0858071

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.379900151