McDonnell Genome Institute

Washington University

Transcript

ZNF571-AS1:1

Chromosome

chr19

Gene Name

ZNF571-AS1

Start

37546665

CPC Label

noncoding

End

37551396

Cancer

OV

Strand

+

Peptide

AAASTASTVFLWALR

Modified Peptide

n[145]AAASTASTVFLWALR

Peptide Length

15

ORF Length

50

Open Reading Frame (ORF)

LLVSRSLLPRAAASTASTVFLWALRALTLRQRQPGTRMRMRQARVTRRDG

Conservation Score

0.081

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.299631

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8996

PhyloCSF Frame 3

0

CNTI Score

-0.317436086