McDonnell Genome Institute

Washington University

Transcript

ZNF561-AS1:12

Chromosome

chr19

Gene Name

ZNF561-AS1

Start

9643435

CPC Label

noncoding

End

9645896

Cancer

OV

Strand

+

Peptide

TVLFLSVIKTIHIYILYCIIK

Modified Peptide

n[145]TVLFLSVIKTIHIYILYCIIK

Peptide Length

21

ORF Length

40

Open Reading Frame (ORF)

MTVLFLSVIKTIHIYILYCIIKRFSKICFIVNTLKGFMEN

Conservation Score

0.142

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0286364

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6326

PhyloCSF Frame 3

0

CNTI Score

-0.371403441