McDonnell Genome Institute

Washington University

Transcript

ZNF528-AS1:3

Chromosome

chr19

Gene Name

ZNF528-AS1

Start

52388841

CPC Label

noncoding

End

52397757

Cancer

OV

Strand

-

Peptide

SGEGQGLQDPR

Modified Peptide

n[145]SGEGQGLQDPR

Peptide Length

11

ORF Length

158

Open Reading Frame (ORF)

LPVEVLLQSPETSLYLQIQGGQRAMHPWSMKPPIKEEKGRRKSGEGQGLQDPRTRKSSRPPWDWGCVAALQELTRERSRWEAPRAGINLAVRTLKKVRASAGDTEGFEAGKLRDKSCLYGPVAEARGTRPHGTVSIKPLCLHKLPSLGYFFISSVRTD

Conservation Score

0.997

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.238861

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7583

PhyloCSF Frame 3

0

CNTI Score

-0.343365871