McDonnell Genome Institute

Washington University

Transcript

ZNF503-AS2:3

Chromosome

chr10

Gene Name

ZNF503-AS2

Start

75401527

CPC Label

noncoding

End

75408982

Cancer

CCRC

Strand

+

Peptide

LSTPGAK

Modified Peptide

n[230]LSTPGAK

Peptide Length

7

ORF Length

194

Open Reading Frame (ORF)

LSTPGAKGTCTPSVFSFAVIEIPRGAAQPPGIDGISLAVVCAAFIRIHPARRHPARNGSRLACTPTPRPNAGLEVVSSARVAASLPSEGGWTSGAPRSSGLSLPGSAWQPPPLPVLRKPAWPGSPAVKNESKFPNRGSRNFPRRRLPPAPVSGEPPERCKLAREIRWRLWKAHEGWGGGAKRPLGDPAWSGVKR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

35

CPC Coding Probability

0.0407514

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9941

PhyloCSF Frame 3

0

CNTI Score

-0.283017191