McDonnell Genome Institute

Washington University

Transcript

ZNF503-AS2:29

Chromosome

chr10

Gene Name

ZNF503-AS2

Start

75404027

CPC Label

noncoding

End

75405149

Cancer

OV

Strand

+

Peptide

GPGTEILGPATGPGGTQPR

Modified Peptide

n[145]GPGTEILGPATGPGGTQPR

Peptide Length

19

ORF Length

72

Open Reading Frame (ORF)

MVVLLTPRAHLWAAIAAASPRGPGTEILGPATGPGGTQPRASLPSLQTQLFPLSSNSSSLLRRRLRGGSLST

Conservation Score

0.909

PhyloCSF Frame 1

-3.8

No. of Spectra

1

CPC Coding Probability

0.0404132

PhyloCSF Frame 2 

-2.651

CNTI Index

noncoding

Max Probability

0.6494

PhyloCSF Frame 3

-3.493

CNTI Score

-0.291104115