McDonnell Genome Institute

Washington University

Transcript

ZNF433-AS1:30

Chromosome

chr19

Gene Name

ZNF433-AS1

Start

11987655

CPC Label

noncoding

End

12004778

Cancer

BRCA-Luminal A

Strand

+

Peptide

MSLSDRPR

Modified Peptide

n[145]MSLSDRPR

Peptide Length

8

ORF Length

58

Open Reading Frame (ORF)

MPLRCSLGNESETLSQKKKKKKKKKRMSLSDRPRSLKLSWDLDRRKIHSTHTGICRHR

Conservation Score

0.368

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0602026

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.376002684