McDonnell Genome Institute

Washington University

Transcript

ZNF433-AS1:27

Chromosome

chr19

Gene Name

ZNF433-AS1

Start

11987655

CPC Label

noncoding

End

11995675

Cancer

EOGC

Strand

+

Peptide

VSGPEAAHDSLVLFISGR

Modified Peptide

n[145]VSGPEAAHDSLVLFISGR

Peptide Length

18

ORF Length

36

Open Reading Frame (ORF)

LAEGNNPRKPRVSGPEAAHDSLVLFISGRQELQGKS

Conservation Score

0.608

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.0569663

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

0

CNTI Score

-0.311101454