McDonnell Genome Institute

Washington University

Transcript

ZNF385D-AS1:2

Chromosome

chr3

Gene Name

ZNF385D-AS1

Start

21542815

CPC Label

noncoding

End

21579959

Cancer

CRC

Strand

+

Peptide

ILQTQWLK

Modified Peptide

Peptide Length

8

ORF Length

93

Open Reading Frame (ORF)

LYCDVKIKDSYNKILQTQWLKTSEIYHLTCLEARNLKSRCCQIHASSETCRGTSFLASRLWCPLSHRYIIPILPFCIVFSLCLSVSVPKFLLL

Conservation Score

0.46

PhyloCSF Frame 1

-4.63

No. of Spectra

1

CPC Coding Probability

0.0563113

PhyloCSF Frame 2 

-4.506

CNTI Index

noncoding

Max Probability

0.8668

PhyloCSF Frame 3

-4.385

CNTI Score

-0.453447965