McDonnell Genome Institute

Washington University

Transcript

ZNF350-AS1:3

Chromosome

chr19

Gene Name

ZNF350-AS1

Start

51949136

CPC Label

noncoding

End

51981520

Cancer

BRCA-Luminal A

Strand

+

Peptide

AQGPCPLEVR

Modified Peptide

n[145]AQGPCPLEVR

Peptide Length

10

ORF Length

80

Open Reading Frame (ORF)

LPNKYGGLCKAQGPCPLEVRCSLTPSPKYTLLSPVFIPTFTPICAVPWVHVGYGPPPRLADFCIFSRDRISASWSGWPST

Conservation Score

0.133

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0181222

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.418231713