McDonnell Genome Institute

Washington University

Transcript

ZNF341-AS1:7

Chromosome

chr20

Gene Name

ZNF341-AS1

Start

33793786

CPC Label

noncoding

End

33812320

Cancer

OV

Strand

-

Peptide

LLTSGDPPASASQSAGIIGVSHHTR

Modified Peptide

n[145]LLTSGDPPASASQSAGIIGVSHHTR

Peptide Length

25

ORF Length

69

Open Reading Frame (ORF)

MGFHHVGQDSLKLLTSGDPPASASQSAGIIGVSHHTRLKMSFFTFLSMPLLQLLKMFTVSHDSPSLCGE

Conservation Score

0.523

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0630961

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9043

PhyloCSF Frame 3

0

CNTI Score

-0.407196674