McDonnell Genome Institute

Washington University

Transcript

ZNF341-AS1:5

Chromosome

chr20

Gene Name

ZNF341-AS1

Start

33787477

CPC Label

noncoding

End

33788749

Cancer

OV

Strand

-

Peptide

AEGEGSEPAR

Modified Peptide

n[145]AEGEGSEPAR

Peptide Length

10

ORF Length

140

Open Reading Frame (ORF)

LVWPENKAEGEGSEPARSAWEDLGGRAKDLAFIYLFFLRQSLALSPRLECSGKISGESLQPLPSGFKQSSYLSLLSRWDYRCVPPRPANFCIFSRDGGFHHVGQAGLELLTSSDPPALASQSAGITGMSHRAQPGLWLLL

Conservation Score

0.115

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.163178

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2391

PhyloCSF Frame 3

0

CNTI Score

-0.353354904