McDonnell Genome Institute

Washington University

Transcript

ZNF30-AS1:1

Chromosome

chr19

Gene Name

ZNF30-AS1

Start

34923197

CPC Label

noncoding

End

34926828

Cancer

OSCC

Strand

-

Peptide

LEISDEAVSWK

Modified Peptide

n[145]LEISDEAVSWK

Peptide Length

11

ORF Length

33

Open Reading Frame (ORF)

LEISDEAVSWKREEGYSQTLQLESEHPVENDSP

Conservation Score

0.595

PhyloCSF Frame 1

0

No. of Spectra

42

CPC Coding Probability

0.0471769

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.983

PhyloCSF Frame 3

0

CNTI Score

-0.336111961