McDonnell Genome Institute

Washington University

Transcript

ZNF236-DT:21

Chromosome

chr18

Gene Name

ZNF236-DT

Start

76805452

CPC Label

noncoding

End

76809801

Cancer

CCRC

Strand

-

Peptide

AQCPEDIPPLLFVLSCPLSASAFK

Modified Peptide

AQCPEDIPPLLFVLSCPLSASAFK

Peptide Length

24

ORF Length

79

Open Reading Frame (ORF)

LFLHIMLCFAYGQAMEAGEAALGLLHTQRALCPPQASFSPEERAQCPEDIPPLLFVLSCPLSASAFKKHLLARRGGSCL

Conservation Score

0.289

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0756934

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9057

PhyloCSF Frame 3

0

CNTI Score

-0.301366549