McDonnell Genome Institute

Washington University

Transcript

ZNF197-AS1:2

Chromosome

chr3

Gene Name

ZNF197-AS1

Start

44583336

CPC Label

noncoding

End

44624945

Cancer

CCRC

Strand

-

Peptide

SDIFISR

Modified Peptide

n[272]SDIFISR

Peptide Length

7

ORF Length

50

Open Reading Frame (ORF)

MSDIFISRNRILIFLISFVSAKQIQSFPLIFAYIVIISLISLFVDSLCQF

Conservation Score

0.982

PhyloCSF Frame 1

-5.628

No. of Spectra

1

CPC Coding Probability

0.150284

PhyloCSF Frame 2 

-4.182

CNTI Index

coding

Max Probability

0.5797

PhyloCSF Frame 3

-5.116

CNTI Score

0.711791778