McDonnell Genome Institute

Washington University

Transcript

ZMIZ1-AS1:33

Chromosome

chr10

Gene Name

ZMIZ1-AS1

Start

79040593

CPC Label

coding

End

79067434

Cancer

BRCA-Luminal B

Strand

-

Peptide

LWWGCGEAR

Modified Peptide

n[145]LWWGCGEAR

Peptide Length

9

ORF Length

54

Open Reading Frame (ORF)

LAPQSAGIIGMSHRTRPPNAILRVRGRRRVGIEWVLEGKLWWGCGEARVGHGPA

Conservation Score

0.269

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2998

PhyloCSF Frame 3

0

CNTI Score

-0.300813066