McDonnell Genome Institute

Washington University

Transcript

ZMIZ1-AS1:28

Chromosome

chr10

Gene Name

ZMIZ1-AS1

Start

79023936

CPC Label

noncoding

End

79068775

Cancer

OV

Strand

-

Peptide

LHGHSRHAQR

Modified Peptide

n[145]LHGHSRHAQR

Peptide Length

10

ORF Length

115

Open Reading Frame (ORF)

LGAPTRGSSPSRPTPPPREHPTTRPLWLTSTATLTETPTRTAHTFAPSALQTRSPPNHKRAPTHSLTFPHKDARLHGHSRHAQRHAVTHTHRCTQPHIQSKNKTRNVPLGTKSSR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.128443

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8925

PhyloCSF Frame 3

0

CNTI Score

-0.349895337