McDonnell Genome Institute

Washington University

Transcript

ZMIZ1-AS1:2

Chromosome

chr10

Gene Name

ZMIZ1-AS1

Start

79017456

CPC Label

noncoding

End

79068779

Cancer

OSCC

Strand

-

Peptide

IGAATVSEARR

Modified Peptide

n[145]IGAATVSEARR

Peptide Length

11

ORF Length

60

Open Reading Frame (ORF)

MLSLGRDHLGEEAKITLLTREPLPRAGTPPPGVHSWPRALSGTRIGAATVSEARRGRELE

Conservation Score

1

PhyloCSF Frame 1

-3.836

No. of Spectra

5

CPC Coding Probability

0.116442

PhyloCSF Frame 2 

-2.797

CNTI Index

noncoding

Max Probability

0.9631

PhyloCSF Frame 3

-1.841

CNTI Score

-0.332934292