McDonnell Genome Institute

Washington University

Transcript

ZKSCAN2-DT:11

Chromosome

chr16

Gene Name

ZKSCAN2-DT

Start

25257589

CPC Label

coding

End

25284056

Cancer

EOGC

Strand

+

Peptide

LGGNWIVGAVFPK

Modified Peptide

n[145]LGGNWIVGAVFPK

Peptide Length

13

ORF Length

121

Open Reading Frame (ORF)

LGGNWIVGAVFPKLFLFFETVLLLLPRLECSGTSSAHCNLHLLGSSNYSASASQVAGITGVHDHTCLIFFVFLVETGFHHVGQAGLERLTLGDPPALASQSDGITGVSHHAQPQSCSCDSE

Conservation Score

0.748

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.514876

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8453

PhyloCSF Frame 3

0

CNTI Score

0.675264405