McDonnell Genome Institute

Washington University

Transcript

ZFPM2-AS1:14

Chromosome

chr8

Gene Name

ZFPM2-AS1

Start

105786779

CPC Label

coding

End

105791223

Cancer

OV

Strand

-

Peptide

LIFDKPQK

Modified Peptide

n[145]LIFDKPQK

Peptide Length

8

ORF Length

357

Open Reading Frame (ORF)

LIFDKPQKNKQWGKDSLFNKWCWENWLAICRKLKLDPFLTPYTKINSRWIKDLNVRPKTIKTLEENLGITIQDIGMGKDFMSKTPKAMATKAKIDKWDLIKLKSFCTAKETTIRVNRQPTKWEKIFASYSSDKGLISRIYNELQQIYKKKTNNPIKKWAKDMNRHFSKEDIYAAKKHMKKCSPSLAIREMQIKTTMRYHLTPVRMAIIKKSGNNRCCRGCGEIGTLLHCWGDCKLVQPLWKSVWRFLRDLELEIPFDPAIPLLGIYPKDYKSCCYKDTCTRMFIAALFTIGKTWNQPKCPTMIDWIKKMWHIYTMEYYVAIKKDEFMSFVGTWMKLEIIILSKLSQEQKPNTAYSHS

Conservation Score

0.495

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.975617

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

0

CNTI Score

-0.35439927