McDonnell Genome Institute

Washington University

Transcript

ZBED5-AS1:32

Chromosome

chr11

Gene Name

ZBED5-AS1

Start

10899229

CPC Label

noncoding

End

10914529

Cancer

LUAD

Strand

+

Peptide

QFLLEQTK

Modified Peptide

n[230]QFLLEQTK

Peptide Length

8

ORF Length

97

Open Reading Frame (ORF)

LSELNSILGHPVGVHIELEYCLVWKTHTFGVEKQFLLEQTKSEGRGFNPDGFLVSGFQSQQPFLPLSSVAYSYHLIIHFYIFLMLDGVGFIDPKGLN

Conservation Score

0.345

PhyloCSF Frame 1

-4.775

No. of Spectra

2

CPC Coding Probability

0.354774

PhyloCSF Frame 2 

-4.819

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-3.415

CNTI Score

-0.359725923