McDonnell Genome Institute

Washington University

Transcript

ZBED5-AS1:29

Chromosome

chr11

Gene Name

ZBED5-AS1

Start

10858224

CPC Label

noncoding

End

10881418

Cancer

HCC

Strand

+

Peptide

LALDLDEAK

Modified Peptide

n[230]LALDLDEAK

Peptide Length

9

ORF Length

62

Open Reading Frame (ORF)

LISYSYKINIIKNITRWVAELKWKLNLETHQVIYVTIRALGASGILRLALDLDEAKCPGPSE

Conservation Score

0.706

PhyloCSF Frame 1

-4.569

No. of Spectra

1

CPC Coding Probability

0.0455793

PhyloCSF Frame 2 

-3.527

CNTI Index

coding

Max Probability

0.8984

PhyloCSF Frame 3

-4.729

CNTI Score

0.578917117