McDonnell Genome Institute

Washington University

Transcript

ZBED5-AS1:24

Chromosome

chr11

Gene Name

ZBED5-AS1

Start

10858224

CPC Label

noncoding

End

10877478

Cancer

OSCC

Strand

+

Peptide

ENSLHILDASPLLK

Modified Peptide

n[145]ENSLHILDASPLLK

Peptide Length

14

ORF Length

77

Open Reading Frame (ORF)

LYFFRDRVSLCCPGWSRTSGLKQSSLFGLLKCRDYRRENSLHILDASPLLKFNIFYLSILVFVACVFEVLAINLCLD

Conservation Score

0.458

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.329509

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9031

PhyloCSF Frame 3

0

CNTI Score

-0.315766299