McDonnell Genome Institute

Washington University

Transcript

ZBED5-AS1:12

Chromosome

chr11

Gene Name

ZBED5-AS1

Start

10865321

CPC Label

noncoding

End

10910458

Cancer

OSCC

Strand

+

Peptide

LLLPGQLLLMDVSLMKK

Modified Peptide

n[145]LLLPGQLLLM[147]DVSLM[147]KK

Peptide Length

17

ORF Length

62

Open Reading Frame (ORF)

LQLWFEGSLGGLALWWGENTLCLRGLWVEEHPMKCIRLLLPGQLLLMDVSLMKKNHLLLADS

Conservation Score

0.479

PhyloCSF Frame 1

-4.659

No. of Spectra

37

CPC Coding Probability

0.0930862

PhyloCSF Frame 2 

-4.124

CNTI Index

noncoding

Max Probability

0.9857

PhyloCSF Frame 3

-4.72

CNTI Score

-0.359725923