McDonnell Genome Institute

Washington University

Transcript

ZBED5-AS1:1

Chromosome

chr11

Gene Name

ZBED5-AS1

Start

10856901

CPC Label

noncoding

End

10879254

Cancer

CCRC

Strand

+

Peptide

SSTPPLRR

Modified Peptide

n[230]SSTPPLRR

Peptide Length

8

ORF Length

60

Open Reading Frame (ORF)

LDFATENSVELLVHVKDQDPSRCQRTQKSRKLLFSERRSSTPPLRRCFPEFLEDKESGLL

Conservation Score

0.651

PhyloCSF Frame 1

-3.223

No. of Spectra

9

CPC Coding Probability

0.174487

PhyloCSF Frame 2 

-2.554

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

-3.665

CNTI Score

-0.306512157