McDonnell Genome Institute

Washington University

Transcript

ZBED3-AS1:19

Chromosome

chr5

Gene Name

ZBED3-AS1

Start

77138468

CPC Label

noncoding

End

77142323

Cancer

LUAD

Strand

+

Peptide

DGLVAVGWIR

Modified Peptide

n[230]DGLVAVGWIR

Peptide Length

10

ORF Length

50

Open Reading Frame (ORF)

LGELMYRDGLVAVGWIREPQLLSKSLQFIQHLHSAPSLQQHPHGNPHFLG

Conservation Score

0.559

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0184789

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.342847888