McDonnell Genome Institute

Washington University

Transcript

ZBED3-AS1:17

Chromosome

chr5

Gene Name

ZBED3-AS1

Start

77118321

CPC Label

noncoding

End

77166909

Cancer

PRAD

Strand

+

Peptide

LLPMSSFPLAWQQMQLWSGGR

Modified Peptide

Peptide Length

21

ORF Length

58

Open Reading Frame (ORF)

LLQHSTGSKGKEENAECVGGTSNLFGRTRLLPMSSFPLAWQQMQLWSGGRGREESLCC

Conservation Score

0.834

PhyloCSF Frame 1

-5.694

No. of Spectra

2

CPC Coding Probability

0.460287

PhyloCSF Frame 2 

-2.348

CNTI Index

noncoding

Max Probability

0.769

PhyloCSF Frame 3

-5.098

CNTI Score

-0.315703812