McDonnell Genome Institute

Washington University

Transcript

YEATS2-AS1:2

Chromosome

chr3

Gene Name

YEATS2-AS1

Start

183807907

CPC Label

noncoding

End

183810548

Cancer

LUAD

Strand

-

Peptide

LSQSTTK

Modified Peptide

n[230]LSQSTTK

Peptide Length

7

ORF Length

37

Open Reading Frame (ORF)

LSQSTTKLWDLISHLLERRETEPRQARRDVNRSIKST

Conservation Score

0.021

PhyloCSF Frame 1

-4.438

No. of Spectra

16

CPC Coding Probability

0.228565

PhyloCSF Frame 2 

-0.915

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

-5.109

CNTI Score

-0.420545947