McDonnell Genome Institute

Washington University

Transcript

XIST:1

Chromosome

chrX

Gene Name

XIST

Start

73820655

CPC Label

noncoding

End

73852753

Cancer

OV

Strand

-

Peptide

LIWIEGPK

Modified Peptide

n[145]LIWIEGPK

Peptide Length

8

ORF Length

57

Open Reading Frame (ORF)

LPCEMIQDQNKALDCSKTQNSSRAEGGRLIWIEGPKYKTDGLRLETRGLRWKAHVPR

Conservation Score

0.994

PhyloCSF Frame 1

-4.053

No. of Spectra

1

CPC Coding Probability

0.219129

PhyloCSF Frame 2 

-4.449

CNTI Index

coding

Max Probability

0.9948

PhyloCSF Frame 3

-4.076

CNTI Score

0.62199196