McDonnell Genome Institute

Washington University

Transcript

WWOX-AS1:6

Chromosome

chr16

Gene Name

WWOX-AS1

Start

78237487

CPC Label

noncoding

End

78241740

Cancer

OV

Strand

-

Peptide

GLYMDISKLEPR

Modified Peptide

n[145]GLYM[147]DISKLEPR

Peptide Length

12

ORF Length

59

Open Reading Frame (ORF)

MLTFTEHLLCAGNHADGTPNPLNRWISLGFGITKKGLYMDISKLEPRHFLDEGSLIPRR

Conservation Score

0.665

PhyloCSF Frame 1

-4.772

No. of Spectra

1

CPC Coding Probability

0.0252537

PhyloCSF Frame 2 

-4.443

CNTI Index

noncoding

Max Probability

0.3504

PhyloCSF Frame 3

-1.401

CNTI Score

-0.321107097