McDonnell Genome Institute

Washington University

Transcript

WT1-AS:10

Chromosome

chr11

Gene Name

WT1-AS

Start

32436038

CPC Label

noncoding

End

32440072

Cancer

OV

Strand

+

Peptide

GVAMILGSLGK

Modified Peptide

n[145]GVAMILGSLGK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

LSGRGVAMILGSLGKEVALCGFQRSGLKANVPQLGGRELHQL

Conservation Score

0.07

PhyloCSF Frame 1

-3.849

No. of Spectra

1

CPC Coding Probability

0.0830791

PhyloCSF Frame 2 

-1.825

CNTI Index

noncoding

Max Probability

0.9132

PhyloCSF Frame 3

-1.644

CNTI Score

-0.283649166