McDonnell Genome Institute

Washington University

Transcript

WDFY3-AS2:3

Chromosome

chr4

Gene Name

WDFY3-AS2

Start

84966275

CPC Label

noncoding

End

84967646

Cancer

BRCA-Luminal A

Strand

+

Peptide

LGSAFLNPTPFSWMLSEAMEKR

Modified Peptide

n[145]LGSAFLNPTPFSWM[147]LSEAM[147]EKR

Peptide Length

22

ORF Length

35

Open Reading Frame (ORF)

LGSAFLNPTPFSWMLSEAMEKRKEVSGFPLINIRQ

Conservation Score

1

PhyloCSF Frame 1

-3.149

No. of Spectra

1

CPC Coding Probability

0.182845

PhyloCSF Frame 2 

-1.814

CNTI Index

noncoding

Max Probability

0.9681

PhyloCSF Frame 3

-1.435

CNTI Score

-0.306643875