McDonnell Genome Institute

Washington University

Transcript

WDFY3-AS2:16

Chromosome

chr4

Gene Name

WDFY3-AS2

Start

84965650

CPC Label

coding

End

85008758

Cancer

CCRC

Strand

+

Peptide

AGQAQETGPRR

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

230

Open Reading Frame (ORF)

LAAAAAPGQGGPWGGQQLGRGLSLGGAGAGPRVGSASAPHEQSGQARRAEAAPPLRERGGRGGWRGYSPEGRRRARAGQAQETGPRRAGAPRRGRTGYGEGATGATSAAGPGSPAPRAGGRGPSSILRPRGMGTGPPGQAAVLGSRGSDAAAFPFSCPRPCSAASSSSLGPRRRRLSLGAPRVSSLHQGRADPQGPSRKVRGCCRFPQLLVAIFNPPPPPAFSTSRWLSD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.524754

PhyloCSF Frame 2 

1.432

CNTI Index

noncoding

Max Probability

0.8159

PhyloCSF Frame 3

7.206

CNTI Score

-0.258395285