McDonnell Genome Institute

Washington University

Transcript

WDFY3-AS2:14

Chromosome

chr4

Gene Name

WDFY3-AS2

Start

85000686

CPC Label

noncoding

End

85008748

Cancer

CCRC

Strand

+

Peptide

HYIVMCEVK

Modified Peptide

n[230]HYIVMCEVK

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

LLYLSVSRIAGRHYIVMCEVKTESPPQPSSSWQEEEK

Conservation Score

0.071

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0450346

PhyloCSF Frame 2 

-4.019

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.436672138