McDonnell Genome Institute

Washington University

Transcript

WAC-AS1:14

Chromosome

chr10

Gene Name

WAC-AS1

Start

28507053

CPC Label

noncoding

End

28533025

Cancer

HCC

Strand

-

Peptide

LLTGFSFFSSL

Modified Peptide

n[230]LLTGFSFFSSL

Peptide Length

11

ORF Length

98

Open Reading Frame (ORF)

LLSFTEILYLYFSLEPTDFIPTLLDLFKIICSIHVFKSDFYFSVFISTCQQHLTQLITFFSLKFLILPTRISFSFLLLFLPKWLFLRLLTGFSFFSSL

Conservation Score

0.944

PhyloCSF Frame 1

-3.703

No. of Spectra

1

CPC Coding Probability

0.176785

PhyloCSF Frame 2 

-4.932

CNTI Index

coding

Max Probability

0.5925

PhyloCSF Frame 3

-4.747

CNTI Score

0.735517064