McDonnell Genome Institute

Washington University

Transcript

WAC-AS1:12

Chromosome

chr10

Gene Name

WAC-AS1

Start

28512561

CPC Label

noncoding

End

28533601

Cancer

OV

Strand

-

Peptide

GGRKPPGETTGGRFPK

Modified Peptide

n[145]GGRKPPGETTGGRFPK

Peptide Length

16

ORF Length

140

Open Reading Frame (ORF)

LQRLRVRPEAQREGVLSGELSGRGPRPCAVGRGGRKPPGETTGGRFPKSCLGCSRGSCVLGSGERAPAPSGRCWKPEPSPGRCPSPDAARHRPSAGQGLLRARRAPFRQSSLSTPLPNVEVLQESVLWRHLRKSVSLLDH

Conservation Score

1

PhyloCSF Frame 1

2.333

No. of Spectra

1

CPC Coding Probability

0.165071

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6581

PhyloCSF Frame 3

1.633

CNTI Score

0.755808908