McDonnell Genome Institute

Washington University

Transcript

VWC2L-IT1:2

Chromosome

chr2

Gene Name

VWC2L-IT1

Start

214510195

CPC Label

noncoding

End

214536890

Cancer

OV

Strand

+

Peptide

FTPGISEMCVK

Modified Peptide

n[145]FTPGISEM[147]CVK

Peptide Length

11

ORF Length

67

Open Reading Frame (ORF)

LIPFSCRYWWLESRARPQKSFTEGTYIGPNWTLRFTPGISEMCVKIPSVIYQRLDDLTSSLFCKLMP

Conservation Score

1

PhyloCSF Frame 1

-1.806

No. of Spectra

4

CPC Coding Probability

0.0202298

PhyloCSF Frame 2 

-3.109

CNTI Index

noncoding

Max Probability

0.789

PhyloCSF Frame 3

1.896

CNTI Score

-0.419770858