McDonnell Genome Institute

Washington University

Transcript

VWA8-AS1:2

Chromosome

chr13

Gene Name

VWA8-AS1

Start

41961168

CPC Label

noncoding

End

41981564

Cancer

HCC

Strand

+

Peptide

HRPGTAR

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

69

Open Reading Frame (ORF)

MAQTGGKSLRSSSPKSRHRPGTARTAGVLRAAALGSGKRLAVRETVCSPGCTRPSPAVSLRSHRISGVQ

Conservation Score

0.077

PhyloCSF Frame 1

0.607

No. of Spectra

2

CPC Coding Probability

0.0407536

PhyloCSF Frame 2 

-3.242

CNTI Index

noncoding

Max Probability

0.4075

PhyloCSF Frame 3

-1.994

CNTI Score

-0.34181876