McDonnell Genome Institute

Washington University

Transcript

VLDLR-AS1:8

Chromosome

chr9

Gene Name

VLDLR-AS1

Start

2411588

CPC Label

noncoding

End

2611526

Cancer

OSCC

Strand

-

Peptide

FTQSVSDGPEAFR

Modified Peptide

n[145]FTQSVSDGPEAFR

Peptide Length

13

ORF Length

33

Open Reading Frame (ORF)

LIKKGTDLPSNIRFTQSVSDGPEAFRGNWAVSV

Conservation Score

0.085

PhyloCSF Frame 1

0

No. of Spectra

45

CPC Coding Probability

0.0641824

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9622

PhyloCSF Frame 3

0

CNTI Score

-0.328658581