McDonnell Genome Institute

Washington University

Transcript

VLDLR-AS1:1

Chromosome

chr9

Gene Name

VLDLR-AS1

Start

2535656

CPC Label

coding

End

2643359

Cancer

CCRC

Strand

-

Peptide

VHIWLFSRFRWR

Modified Peptide

n[230]VHIWLFSRFRWR

Peptide Length

12

ORF Length

86

Open Reading Frame (ORF)

LCTGIGRVHIWLFSRFRWRRSPGAPSTARAAARAPRARTCPWCPPGWCRRRRRRRRSLRTTSYQSFRKEEEGSKLDIEDYHMNQKG

Conservation Score

1

PhyloCSF Frame 1

3.069

No. of Spectra

4

CPC Coding Probability

0.959996

PhyloCSF Frame 2 

0.698

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

10.524

CNTI Score

-0.290569733